Recombinant CCL4 (MIP-1β), biotinylated

$3,776.00

Host	Quantity	Applications	Species Reactivity	Data Sheet
	100ug	Migration assay	Human

SKU: 50191PB-100 Categories: Chemokines, Products

Overview

Product Name CCL4, biotinylated (50191PB-100)

Description Recombinant human CCL4 is produced in E. coli

Target CCL4, biotinylated

Product Background CCL4, also known as Macrophage Inflammatory Protein-1beta (MIP-1b) is a small cytokine (~9kDa) that belongs to the CC chemokine family. CCL4 binds to CCR1, CCR2 isoform B, and CCR5. CCL4 is one of the major HIV-suppressive factors produced by CD8+ T-cells; recombinant MIP-1b induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form of MIP-1b (aa 3-69) retains the abilities to induce down-modulation of surface expression of CCR5 and to inhibit CCR5-mediated entry of HIV-1 into T-cells.

Species Reactivity Human

Applications Migration assay

Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in cells expressing recombinant CCR5.

Conjugate Biotin

Source Recombinant human CCL4 is produced in E. coli

Properties

Form Lyophilized.

Concentration Lot Specific

Molecular Mass Molecular Mass: 10.237 kDa

Purity >97% by SDS-PAGE

Target Name C-C motif chemokine 4

Target ID CCL4, biotinylated

Alternative Names rHuCCL4-biotin, MIP-1beta

Sequence Location Secreted.

Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTK RSKQVCADPSESWVQEYVYDLELNMolecular Mass10.237kDa by Mass Spec.Purity>97% by SDS-PAGEActivityEC50 = 0.32-1.3nM determined by Migration Assay in cells expressing recombinant CCR5.Endotoxin Level<0.01 EU per 1ug of protein by LAL method. FormLyophilized. Carrier ProteinNone.

Biological Activity CCL4, biotinylated

Biological Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. RPubMed:10540332, PubMed:12070155, PubMed:8525373}.

Background CCL4, also known as Macrophage Inflammatory Protein-1beta (MIP-1b) is a small cytokine (~9kDa) that belongs to the CC chemokine family. CCL4 binds to CCR1, CCR2 isoform B, and CCR5. CCL4 is one of the major HIV-suppressive factors produced by CD8+ T-cells; recombinant MIP-1b induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form of MIP-1b (aa 3-69) retains the abilities to induce down-modulation of surface expression of CCR5 and to inhibit CCR5-mediated entry of HIV-1 into T-cells.

Handling

Storage Store at 2 - 8ºC. Do not Freeze.

Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.

Data Sheet