Recombinant CCL14 (HCC-1)

$67.00

Host	Quantity	Applications	Species Reactivity	Data Sheet
	5ug	Migration assay	Human

SKU: 50192P-5 Categories: Chemokines, Products

Overview

Product Name CCL14 (50192P-5)

Description Recombinant human CCL14 is produced in E. coli

Target CCL14

Product Background CCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of full- length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.

Species Reactivity Human

Applications Migration assay

Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in cells expressing CCR1.

Source Recombinant human CCL14 is produced in E. coli

Properties

Form Lyophilized.

Concentration Lot Specific

Molecular Mass Molecular Mass: 7.801 kDa

Purity >97% by SDS-PAGE

Target Name C-C motif chemokine 14

Target ID CCL14

Alternative Names rHuCCL14, HCC-1

Sequence Location Secreted.

Sequence GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC TNPSDKWVQDYIKDMKENMolecular Mass7.801kDa by Mass Spec.Purity>97% by SDS-PAGEActivityEC50 = 0.1-0.4nM determined by Migration Assay in cells expressing CCR1.Endotoxin Level<0.01 EU per 1ug of protein by LAL method. FormLyophilized. Carrier ProteinNone.

Biological Activity CCL14

Biological Function Has weak activities on human monocytes and acts via receptors that also rPubMed:11085751}.

Background CCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of full- length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.

Handling

Storage Store at 2 - 8ºC. Do not Freeze.

Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.

Data Sheet