CXCL12a (50180P-50)
$350.00
Host | Quantity | Applications | Species Reactivity | Data Sheet | |
---|---|---|---|---|---|
50ug | Calcium flux and SPA binding assays | Human |
SKU: 50180P-50
Categories: Chemokines, Products
Overview
Product Name CXCL12a (50180P-50)
Description Recombinant human CXCL12a is produced in E. coli
Target CXCL12a
Species Reactivity Human
Applications Calcium flux and SPA binding assays
Associated Products #1009 Anti-CXCR4 N-terminus Antibody#1012 Anti-CXCR4 2nd Extracellular Loop Antibody
Source Recombinant human CXCL12a is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 7.98 kDa
Purity >97%
Background CXCL12a and CXCL12b, also known as Stromal Cell-Derived Factor 1a and 1b (SDF-1a and SDF-1b), are small cytokines that belong to the intercrine family. Both forms of CXCL12 are produced by alternate splicing of the same gene. CXCL12 is strongly chemotactic for T- lymphocytes and monocytes, and it plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism. It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumor progression. CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12. In breast cancer, however, increased expression of CXCL12 is associated with a reduced risk of distant metastasis. By blocking CXCR4, a major coreceptor for HIV-1 entry, CXCL12 acts as an endogenous inhibitor of CXCR4-tropic HIV-1 strains. CXCL12 was shown to be expressed in many tissues in mice including brain, thymus, heart, lung, liver, kidney, spleen and bone marrow.
Specificity Information
Target Name Stromal cell-derived factor 1
Target ID CXCL12a
Alternative Names rHuCXCL12a, SDF-1alpha
Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK
Biological Activity CXCL12a
Background CXCL12a and CXCL12b, also known as Stromal Cell-Derived Factor 1a and 1b (SDF-1a and SDF-1b), are small cytokines that belong to the intercrine family. Both forms of CXCL12 are produced by alternate splicing of the same gene. CXCL12 is strongly chemotactic for T- lymphocytes and monocytes, and it plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism. It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumor progression. CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12. In breast cancer, however, increased expression of CXCL12 is associated with a reduced risk of distant metastasis. By blocking CXCR4, a major coreceptor for HIV-1 entry, CXCL12 acts as an endogenous inhibitor of CXCR4-tropic HIV-1 strains. CXCL12 was shown to be expressed in many tissues in mice including brain, thymus, heart, lung, liver, kidney, spleen and bone marrow.
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet
Data Sheet Download PDF Data Sheet