Recombinant CCL5 (Rantes), biotinylated

$2,257.00

Host	Quantity	Applications	Species Reactivity	Data Sheet
	50ug	Migration assay	Human

SKU: 50181PB-50 Categories: Chemokines, Products

Overview

Product Name CCL5, biotinylated (50181PB-50)

Description Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91

Target CCL5, biotinylated

Product Background CCL5, also known as Regulated on Activation, Normal T-cell Expressed and Secreted (RANTES), is a proinflammatory chemokine that induces migration and activation of leukocytes, and is also implied in HIV infection. CCL5 binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infections is dependent upon concentration and on the binding of cell surface glycosaminoglycans.

Species Reactivity Human

Applications Migration assay

Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in cells expressing recombinant CCR5.

Conjugate Biotin

Associated Products #1112 Anti-HIV Co-Receptor CCR5 Antibody 50181PB-2 2ug

Source Recombinant human CCL5, produced in E. coli

Properties

Form Lyophilized.

Concentration Lot Specific

Purification c

Purity >97% by SDS-PAGE

Target Name C-C motif chemokine 5

Target ID CCL5, biotinylated

Alternative Names rHuCCL5-biotin, Rantes

Sequence Location Secreted.

Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMSPurity>97% by SDS-PAGEActivityEC50 = 0.25-0.50nM determined by Migration Assay in cells expressing recombinant CCR5.Endotoxin Level<0.01 EU per 1ug of protein by LAL method. FormLyophilized. Carrier ProteinNone.

Biological Activity CCL5, biotinylated

Biological Function Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. RPubMed:1380064, PubMed:15923218, PubMed:16791620, PubMed:17001303, PubMed:23979485, PubMed:8525373, PubMed:9516414}.

Background CCL5, also known as Regulated on Activation, Normal T-cell Expressed and Secreted (RANTES), is a proinflammatory chemokine that induces migration and activation of leukocytes, and is also implied in HIV infection. CCL5 binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infections is dependent upon concentration and on the binding of cell surface glycosaminoglycans.

Handling

Storage Store at 2 - 8ºC. Do not Freeze.

Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.

Data Sheet