CCL4, biotinylated (50191PB-2)
SKU: 50191PB-2
Categories: Chemokines, Products
Overview
Product Name CCL4, biotinylated (50191PB-2)
Description Recombinant human CCL4 is produced in E. coli
Target CCL4ylated
Species Reactivity Human
Applications Migration assay
Conjugate Biotin
Source Recombinant human CCL4 is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 10.237 kDa
Purity >97% by SDS-PAGE
Background CCL4, also known as Macrophage Inflammatory Protein-1beta (MIP-1b) is a small cytokine (~9kDa) that belongs to the CC chemokine family. CCL4 binds to CCR1, CCR2 isoform B, and CCR5. CCL4 is one of the major HIV-suppressive factors produced by CD8+ T-cells; recombinant MIP-1b induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form of MIP-1b (aa 3-69) retains the abilities to induce down-modulation of surface expression of CCR5 and to inhibit CCR5-mediated entry of HIV-1 into T-cells.
Specificity Information
Target Name C-C motif chemokine 4
Target ID CCL4ylated
Alternative Names rHuCCL4-biotin, MIP-1beta
Sequence Location Secreted.
Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTK RSKQVCADPSESWVQEYVYDLELN
Biological Activity CCL4ylated
Biological Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. RPubMed:10540332, PubMed:12070155, PubMed:8525373}.
Background CCL4, also known as Macrophage Inflammatory Protein-1beta (MIP-1b) is a small cytokine (~9kDa) that belongs to the CC chemokine family. CCL4 binds to CCR1, CCR2 isoform B, and CCR5. CCL4 is one of the major HIV-suppressive factors produced by CD8+ T-cells; recombinant MIP-1b induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form of MIP-1b (aa 3-69) retains the abilities to induce down-modulation of surface expression of CCR5 and to inhibit CCR5-mediated entry of HIV-1 into T-cells.
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in cells expressing recombinant CCR5.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet
Data Sheet
Download PDF Data Sheet
