Awaiting product image

CCL3 (50187P-5)

$75.00

Host Quantity Applications Species Reactivity Data Sheet  
5ug Migration assay Human
SKU: 50187P-5 Categories: ,
Overview
Product Name CCL3 (50187P-5)
Description Recombinant human CCL3 is produced in E. coli
Target CCL3
Species Reactivity Human
Applications Migration assay
Associated Products #1112 Anti-Human CCR5 Antibody
Source Recombinant human CCL3 is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 7.716 kDa
Purity >97% by SDS-PAGE
Background CCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Specificity Information
Target Name C-C motif chemokine 3
Target ID CCL3
Alternative Names rHuCCL3, MIP-1alpha
Sequence Location Secreted.
Sequence SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA
Biological Activity CCL3
Biological Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. RPubMed:8525373}.
Background CCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Application Images
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration of recombinant CCR5- expressing cells.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet