Recombinant CCL3 (MIP-1α)

$156.00

Host	Quantity	Applications	Species Reactivity	Data Sheet
	20ug	Migration assay	Human

SKU: 50187P-20 Categories: Chemokines, Products

Overview

Product Name CCL3 (50187P-20)

Description Recombinant human CCL3 is produced in E. coli

Target CCL3

Product Background CCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Species Reactivity Human

Applications Migration assay

Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration of recombinant CCR5- expressing cells.

Associated Products #1112 Anti-Human CCR5 Antibody 50187P-2 2ug

Source Recombinant human CCL3 is produced in E. coli

Properties

Form Lyophilized.

Concentration Lot Specific

Molecular Mass Molecular Mass: 7.716 kDa

Purity >97% by SDS-PAGE

Target Name C-C motif chemokine 3

Target ID CCL3

Alternative Names rHuCCL3, MIP-1alpha

Sequence Location Secreted.

Sequence SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSAMolecular Mass7.716kDa by Mass Spec.Purity>97% by SDS-PAGEActivityEC50 = 0.2nM determined by migration of recombinant CCR5- expressing cells.Endotoxin Level<0.01 EU per 1ug of protein by LAL method. FormLyophilized. Carrier ProteinNone.

Biological Activity CCL3

Biological Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. RPubMed:8525373}.

Background CCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Handling

Storage Store at 2 - 8ºC. Do not Freeze.

Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.

Data Sheet