Recombinant CCL19 (MIP-3β), biotinylated

$612.00

Host	Quantity	Applications	Species Reactivity	Data Sheet
	10ug	Migration assay	Human

SKU: 50184PB-10 Categories: Chemokines, Products

Overview

Product Name CCL19, biotinylated (50184PB-10)

Description Recombinant human CCL19 produced in E. coli

Target CCL19, biotinylated

Product Background CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.

Species Reactivity Human

Applications Migration assay

Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay with cells expressing recombinant CCR7.

Conjugate Biotin

Source Recombinant human CCL19 produced in E. coli

Properties

Form Lyophilized.

Concentration Lot Specific

Molecular Mass Molecular Mass: 11.22 kDa

Purity >97% by SDS-PAGE

Target Name C-C motif chemokine 19

Target ID CCL19, biotinylated

Alternative Names rHuCCL19-biotin, MIP-3beta

Sequence Location Secreted.

Sequence GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSSMolecular Mass11.22kDa by Mass Spec.Purity>97% by SDS-PAGEActivityEC50 = 18-25nM determined by Migration Assay with cells expressing recombinant CCR7.Endotoxin Level<0.01 EU per 1ug of protein by LAL method. FormLyophilized. Carrier ProteinNone.

Biological Activity CCL19, biotinylated

Biological Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to sPubMed:9498785}.

Background CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.

Handling

Storage Store at 2 - 8ºC. Do not Freeze.

Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.

Data Sheet