Overview
Product Name CCL19 (50184P-50)
Description Recombinant human CCL19 produced in E. coli
Target CCL19
Species Reactivity Human
Applications Calcium flux assay
Source Recombinant human CCL19 produced in E. coli
Properties
Form Lyophilized
Molecular Mass 8.8 kDa
Purity >97% by SDS-PAGE
Background CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.
Specificity Information
Target Name C-C motif chemokine 19
Target ID CCL19
Alternative Names rHuCCL19, MIP-3beta
Sequence Location Secreted.
Sequence GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSS
Biological Activity CCL19
Biological Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to sPubMed:9498785}.
Background CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution. For in vitro investigational use only.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet
Data Sheet
Download PDF Data Sheet
