Recombinant CCL19 (MIP-3β)

$2,454.00

Host	Quantity	Applications	Species Reactivity	Data Sheet
	1000ug	Calcium flux assay	Human

SKU: 50184P-1000 Categories: Chemokines, Products

Overview

Product Name CCL19 (50184P-1000)

Description Recombinant human CCL19 produced in E. coli

Target CCL19

Product Background CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.

Species Reactivity Human

Applications Calcium flux assay

Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.

Source Recombinant human CCL19 produced in E. coli

Properties

Form Lyophilized.

Concentration Lot Specific

Molecular Mass Molecular Mass: 8.8 kDa

Purity >97% by SDS-PAGE

Target Name C-C motif chemokine 19

Target ID CCL19

Alternative Names rHuCCL19, MIP-3beta

Sequence Location Secreted.

Sequence GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSSMolecular Mass8.8kDa by Mass Spec.Purity>97% by SDS-PAGEActivityEC50 = 30nM determined by calcium flux with recombinant human CCR7.Endotoxin Level<0.01 EU per 1ug of protein by LAL method. FormLyophilized. Carrier ProteinNone.

Biological Activity CCL19

Biological Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to sPubMed:9498785}.

Background CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.

Handling

Storage Store at 2 - 8ºC. Do not Freeze.

Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.

Data Sheet